Lineage for d4ntxb_ (4ntx B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637558Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2637559Protein automated matches [190829] (13 species)
    not a true protein
  7. 2637615Species Micrurus tener [TaxId:1114302] [237085] (3 PDB entries)
  8. 2637617Domain d4ntxb_: 4ntx B: [237086]
    Other proteins in same PDB: d4ntxc_
    automated match to d1t8lb_
    complexed with amr, cl, na, nag, p6g

Details for d4ntxb_

PDB Entry: 4ntx (more details), 2.27 Å

PDB Description: structure of acid-sensing ion channel in complex with snake toxin and amiloride
PDB Compounds: (B:) Neurotoxin MitTx-alpha

SCOPe Domain Sequences for d4ntxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ntxb_ g.8.1.0 (B:) automated matches {Micrurus tener [TaxId: 1114302]}
eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg

SCOPe Domain Coordinates for d4ntxb_:

Click to download the PDB-style file with coordinates for d4ntxb_.
(The format of our PDB-style files is described here.)

Timeline for d4ntxb_:

2637617
d4ntxb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d4ntxc_