Lineage for d4ntxc_ (4ntx C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2346583Family a.133.1.0: automated matches [194891] (1 protein)
    not a true family
  6. 2346584Protein automated matches [194892] (2 species)
    not a true protein
  7. 2346585Species Micrurus tener [TaxId:1114302] [237091] (3 PDB entries)
  8. 2346587Domain d4ntxc_: 4ntx C: [237092]
    Other proteins in same PDB: d4ntxb_
    automated match to d1a3da_
    complexed with amr, cl, na, nag, p6g

Details for d4ntxc_

PDB Entry: 4ntx (more details), 2.27 Å

PDB Description: structure of acid-sensing ion channel in complex with snake toxin and amiloride
PDB Compounds: (C:) Basic phospholipase A2 homolog Tx-beta

SCOPe Domain Sequences for d4ntxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ntxc_ a.133.1.0 (C:) automated matches {Micrurus tener [TaxId: 1114302]}
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc

SCOPe Domain Coordinates for d4ntxc_:

Click to download the PDB-style file with coordinates for d4ntxc_.
(The format of our PDB-style files is described here.)

Timeline for d4ntxc_: