| Class g: Small proteins [56992] (90 folds) |
| Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
| Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
| Protein automated matches [190829] (3 species) not a true protein |
| Species Micrurus tener [TaxId:1114302] [237085] (3 PDB entries) |
| Domain d4ntxb_: 4ntx B: [237086] Other proteins in same PDB: d4ntxc_ automated match to d1t8lb_ complexed with amr, cl, na, nag, p6g |
PDB Entry: 4ntx (more details), 2.27 Å
SCOPe Domain Sequences for d4ntxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ntxb_ g.8.1.0 (B:) automated matches {Micrurus tener [TaxId: 1114302]}
eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg
Timeline for d4ntxb_: