Class b: All beta proteins [48724] (177 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (30 species) not a true protein |
Species Brucella abortus [TaxId:359391] [229708] (1 PDB entry) |
Domain d4n27c_: 4n27 C: [229709] automated match to d1v3wa_ complexed with pe5, zn |
PDB Entry: 4n27 (more details), 2.73 Å
SCOPe Domain Sequences for d4n27c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n27c_ b.81.1.0 (C:) automated matches {Brucella abortus [TaxId: 359391]} mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa
Timeline for d4n27c_: