SCOPe 2.06: Domain d4n27f_: 4n27 F:

Lineage for d4n27f_ (4n27 F:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (30 species)
   not a true protein

7. Species Brucella abortus [TaxId:359391] [229708] (1 PDB entry)

8. Domain d4n27f_: 4n27 F: [230271]
   automated match to d4n27c_
   complexed with pe5, zn

Details for d4n27f_

PDB Entry: 4n27, 2.73 Å

PDB Description: X-ray structure of Brucella abortus RicA

PDB Compounds: (F:) Bacterial transferase hexapeptide repeat

SCOPe Domain Sequences for d4n27f_:

Sequence; same for both SEQRES and ATOM records:

>d4n27f_ b.81.1.0 (F:) automated matches {Brucella abortus [TaxId: 359391]}
mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa

Timeline for d4n27f_:

• d4n27f_ first appeared in SCOPe 2.03
  
• d4n27f_ appears in SCOPe 2.05
  
• d4n27f_ appears in SCOPe 2.07
  
• d4n27f_ appears in the current release, SCOPe 2.08