Lineage for d4ma1l2 (4ma1 L:108-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364243Domain d4ma1l2: 4ma1 L:108-214 [238444]
    Other proteins in same PDB: d4ma1c1, d4ma1f1, d4ma1l1
    automated match to d1l7tl2
    complexed with bma, fuc, gal, gla, k, man, nag, peg

Details for d4ma1l2

PDB Entry: 4ma1 (more details), 2.32 Å

PDB Description: unliganded 3 crystal structure of s25-26 fab
PDB Compounds: (L:) S25-26 Fab (Igg1k) Light Chain

SCOPe Domain Sequences for d4ma1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ma1l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4ma1l2:

Click to download the PDB-style file with coordinates for d4ma1l2.
(The format of our PDB-style files is described here.)

Timeline for d4ma1l2:

2364243
d4ma1l2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4ma1l1