SCOPe 2.07: Domain d4ma1c2: 4ma1 C:108-214

Lineage for d4ma1c2 (4ma1 C:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4ma1c2: 4ma1 C:108-214 [240528]
   Other proteins in same PDB: d4ma1c1, d4ma1f1, d4ma1l1
   automated match to d4ma1l2
   complexed with bma, fuc, gal, gla, k, man, nag, peg

Details for d4ma1c2

PDB Entry: 4ma1, 2.32 Å

PDB Description: unliganded 3 crystal structure of s25-26 fab

PDB Compounds: (C:) S25-26 Fab (Igg1k) Light Chain

SCOPe Domain Sequences for d4ma1c2:

Sequence; same for both SEQRES and ATOM records:

>d4ma1c2 b.1.1.2 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4ma1c2:

• d4ma1c2 first appeared in SCOPe 2.04
  
• d4ma1c2 appears in SCOPe 2.06
  
• d4ma1c2 appears in the current release, SCOPe 2.08