Lineage for d4lxha_ (4lxh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510506Species Sphingomonas wittichii [TaxId:392499] [227977] (5 PDB entries)
  8. 2510507Domain d4lxha_: 4lxh A: [227978]
    automated match to d2rhwa_
    complexed with c1e, na; mutant

Details for d4lxha_

PDB Entry: 4lxh (more details), 2.02 Å

PDB Description: crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda
PDB Compounds: (A:) MCP Hydrolase

SCOPe Domain Sequences for d4lxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lxha_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]}
mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
aipqaighvfpncghwvmieypeefctqtlhffgkl

SCOPe Domain Coordinates for d4lxha_:

Click to download the PDB-style file with coordinates for d4lxha_.
(The format of our PDB-style files is described here.)

Timeline for d4lxha_: