Lineage for d4iv1a_ (4iv1 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086889Protein automated matches [190854] (15 species)
    not a true protein
  7. 2086913Species Foot-and-mouth disease virus - type a [TaxId:12111] [196861] (4 PDB entries)
  8. 2086914Domain d4iv1a_: 4iv1 A: [223403]
    automated match to d4iv3a_

Details for d4iv1a_

PDB Entry: 4iv1 (more details), 2.1 Å

PDB Description: Crystal structure of recombinant foot-and-mouth-disease virus A22 empty capsid
PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d4iv1a_:

Sequence, based on SEQRES records: (download)

>d4iv1a_ b.121.4.1 (A:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
ttttgesadpvtttvenyggetqvqrrqhtdvtfimdrfvkiqnlnpthvidlmqthqhg
lvgallraatyyfsdleivvrhdgnltwvpngapeaalsntgnptaylkapftrlalpyt
aphrvlatvyngtskysaggtgrrgdlgplaarvaaqlpasfnfgaiqattihellvrmk
raelycprpllavevssqdrhkqkiiapak

Sequence, based on observed residues (ATOM records): (download)

>d4iv1a_ b.121.4.1 (A:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
ttttgesadpvtttvenyggetqvqrrqhtdvtfimdrfvkiqnlnpthvidlmqthqhg
lvgallraatyyfsdleivvrhdgnltwvpngapeaalsntgnptaylkapftrlalpyt
aphrvlatvyngtskyaqlpasfnfgaiqattihellvrmkraelycprpllavevssqd
rhkqkiiapak

SCOPe Domain Coordinates for d4iv1a_:

Click to download the PDB-style file with coordinates for d4iv1a_.
(The format of our PDB-style files is described here.)

Timeline for d4iv1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4iv1c_