| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Mandelate racemase [54838] (3 species) |
| Species Dickeya dadantii [TaxId:579405] [267742] (1 PDB entry) |
| Domain d4ihca1: 4ihc A:3-116 [266411] Other proteins in same PDB: d4ihca2, d4ihcb2, d4ihcc2, d4ihcd2, d4ihce2, d4ihcf2, d4ihcg2, d4ihch2 complexed with cl, fmt, gol, iod, mg |
PDB Entry: 4ihc (more details), 2 Å
SCOPe Domain Sequences for d4ihca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihca1 d.54.1.1 (A:3-116) Mandelate racemase {Dickeya dadantii [TaxId: 579405]}
klkitnvktiltapggidlavvkvetnepglyglgcatftqrifavksaideymapflig
kdptriediwqsaavsgywrngpimnnalsgvdmalwdikgklagmpvyellgg
Timeline for d4ihca1: