Lineage for d4ihce2 (4ihc E:117-417)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087095Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 protein domains)
  6. 2087181Protein Mandelate racemase [51617] (3 species)
  7. 2087187Species Dickeya dadantii [TaxId:579405] [267743] (1 PDB entry)
  8. 2087192Domain d4ihce2: 4ihc E:117-417 [266420]
    Other proteins in same PDB: d4ihca1, d4ihcb1, d4ihcc1, d4ihcd1, d4ihce1, d4ihcf1, d4ihcg1, d4ihch1
    complexed with cl, fmt, gol, iod, mg

Details for d4ihce2

PDB Entry: 4ihc (more details), 2 Å

PDB Description: Crystal structure of probable mannonate dehydratase Dd703_0947 (target EFI-502222) from Dickeya dadantii Ech703
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4ihce2:

Sequence, based on SEQRES records: (download)

>d4ihce2 c.1.11.2 (E:117-417) Mandelate racemase {Dickeya dadantii [TaxId: 579405]}
kcrdgiplychtdggdevevednirarmeegyqyvrcqmgmyggagtddlkliatqlara
kniqpkrsprsktpgiyfdpeayaksvprlfehlrnklgfgiefihdvhervtpvtaiql
aktlepyqlfyledpvapenidwlrmlrqqsstpismgelfvninewkplidnklidyir
chvstiggitpakklavyselngvrtawhgpgdispvgvcanmhldmsspnfgiqeytpm
ndalrevfpgcpeidqgyayvndkpglgidinetlaekypcdggipswtmartpdgtasr
p

Sequence, based on observed residues (ATOM records): (download)

>d4ihce2 c.1.11.2 (E:117-417) Mandelate racemase {Dickeya dadantii [TaxId: 579405]}
kcrdgiplychtdggdevevednirarmeegyqyvrcqmgmyggpkrsprsktpgiyfdp
eayaksvprlfehlrnklgfgiefihdvhervtpvtaiqlaktlepyqlfyledpvapen
idwlrmlrqqsstpismgelfvninewkplidnklidyirchvstiggitpakklavyse
lngvrtawhgpgdispvgvcanmhldmsspnfgiqeytpmndalrevfpgcpeidqgyay
vndkpglgidinetlaekypcdggipswtmartpdgtasrp

SCOPe Domain Coordinates for d4ihce2:

Click to download the PDB-style file with coordinates for d4ihce2.
(The format of our PDB-style files is described here.)

Timeline for d4ihce2: