SCOPe 2.08: Domain d4ihcg1: 4ihc G:3-116

Lineage for d4ihcg1 (4ihc G:3-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Mandelate racemase [54838] (3 species)

7. Species Dickeya dadantii [TaxId:579405] [267742] (1 PDB entry)

8. Domain d4ihcg1: 4ihc G:3-116 [266423]
   Other proteins in same PDB: d4ihca2, d4ihcb2, d4ihcc2, d4ihcd2, d4ihce2, d4ihcf2, d4ihcg2, d4ihch2
   complexed with cl, fmt, gol, iod, mg

Details for d4ihcg1

PDB Entry: 4ihc, 2 Å

PDB Description: Crystal structure of probable mannonate dehydratase Dd703_0947 (target EFI-502222) from Dickeya dadantii Ech703

PDB Compounds: (G:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4ihcg1:

Sequence; same for both SEQRES and ATOM records:

>d4ihcg1 d.54.1.1 (G:3-116) Mandelate racemase {Dickeya dadantii [TaxId: 579405]}
klkitnvktiltapggidlavvkvetnepglyglgcatftqrifavksaideymapflig
kdptriediwqsaavsgywrngpimnnalsgvdmalwdikgklagmpvyellgg

Timeline for d4ihcg1:

• d4ihcg1 first appeared in SCOPe 2.05
  
• d4ihcg1 appears in SCOPe 2.07