Lineage for d4i9sa_ (4i9s A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2072541Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2072594Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2072601Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (52 PDB entries)
  8. 2072670Domain d4i9sa_: 4i9s A: [228186]
    automated match to d3js1a_
    complexed with ret; mutant

Details for d4i9sa_

PDB Entry: 4i9s (more details), 2.58 Å

PDB Description: crystal structure of the r111k:r132l:y134f:t54v:r59w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.58 angstrom resolution
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d4i9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9sa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikvsttvwt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
ltmtaddvvctlvfvre

SCOPe Domain Coordinates for d4i9sa_:

Click to download the PDB-style file with coordinates for d4i9sa_.
(The format of our PDB-style files is described here.)

Timeline for d4i9sa_: