Lineage for d4i1xb_ (4i1x B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.0: automated matches [191338] (1 protein)
not a true familyProtein automated matches [190215] (33 species)
not a true protein
Species Helicobacter pylori [TaxId:85962] [229231] (3 PDB entries) 
Domain d4i1xb_: 4i1x B: [307534]
automated match to d4r2va_
Details for d4i1xb_
PDB Entry: 4i1x (more details), 1.9 Å
PDB Description: Crystal structure of Cysteine synthase from Helicobacter pylori 26695
PDB Compounds: (B:) Cysteine synthaseSCOPe Domain Sequences for d4i1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1xb_ c.79.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
skgiyl
SCOPe Domain Coordinates for d4i1xb_:
Click to download the PDB-style file with coordinates for d4i1xb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i1xb_:
- d4i1xb_ is new in SCOPe 2.06-stable
- d4i1xb_ appears in SCOPe 2.07
- d4i1xb_ appears in the current release, SCOPe 2.08
View in 3D
