Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (33 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [229231] (3 PDB entries) |
Domain d4i1xb_: 4i1x B: [307534] automated match to d4r2va_ |
PDB Entry: 4i1x (more details), 1.9 Å
SCOPe Domain Sequences for d4i1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1xb_ c.79.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl skgiyl
Timeline for d4i1xb_: