Lineage for d4i1xb_ (4i1x B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907901Species Helicobacter pylori [TaxId:85962] [229231] (3 PDB entries)
  8. 2907903Domain d4i1xb_: 4i1x B: [307534]
    automated match to d4r2va_

Details for d4i1xb_

PDB Entry: 4i1x (more details), 1.9 Å

PDB Description: Crystal structure of Cysteine synthase from Helicobacter pylori 26695
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d4i1xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i1xb_ c.79.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mmiittmqdaigrtpvfkftnkdypiplnsaiyaklehlnpggsvkdrlgqyligegfkt
gkitskttiieptagntgialalvaikhhlktifvvpekfstekqqimralgalvintpt
segisgaikkskelaesipdsylplqfenpdnpaayyhtlapeivqelgtnltsfvagig
sggtfagtarylkeripairligvepegsilnggepgpheiegigvefippffenldidg
fetisdeegfsytrklakkngllvgsssgaafvaalkeaqrlpegsqvltifpdvadryl
skgiyl

SCOPe Domain Coordinates for d4i1xb_:

Click to download the PDB-style file with coordinates for d4i1xb_.
(The format of our PDB-style files is described here.)

Timeline for d4i1xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4i1xa_