Lineage for d4h96a_ (4h96 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153920Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2154061Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2154094Domain d4h96a_: 4h96 A: [196717]
    automated match to d1aoea_
    complexed with 14q, ndp

Details for d4h96a_

PDB Entry: 4h96 (more details), 2.6 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 5-{3-[3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5-methoxyphenyl]prop-1-yn-1-yl}-6-ethylpyrimidine-2,4-diamine (UCP1018)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4h96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h96a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
pnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesip
qkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiynelin
nslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdft
ynytlwtrk

SCOPe Domain Coordinates for d4h96a_:

Click to download the PDB-style file with coordinates for d4h96a_.
(The format of our PDB-style files is described here.)

Timeline for d4h96a_: