SCOPe 2.07: Domain d4h96a_: 4h96 A:

Lineage for d4h96a_ (4h96 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)

8. Domain d4h96a_: 4h96 A: [196717]
   automated match to d1aoea_
   complexed with 14q, ndp

Details for d4h96a_

PDB Entry: 4h96, 2.6 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 5-{3-[3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5-methoxyphenyl]prop-1-yn-1-yl}-6-ethylpyrimidine-2,4-diamine (UCP1018)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4h96a_:

Sequence; same for both SEQRES and ATOM records:

>d4h96a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
pnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesip
qkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiynelin
nslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdft
ynytlwtrk

Timeline for d4h96a_:

• d4h96a_ first appeared in SCOPe 2.02
  
• d4h96a_ appears in SCOPe 2.06
  
• d4h96a_ appears in the current release, SCOPe 2.08