Lineage for d4ga9a_ (4ga9 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein Galectin-1 [100925] (5 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries) 
Domain d4ga9a_: 4ga9 A: [221821]
automated match to d1slta_
Details for d4ga9a_
PDB Entry: 4ga9 (more details), 1.88 Å
PDB Description: crystal structure of rat galectin-1 in complex with lactose
PDB Compounds: (A:) galectin-1SCOPe Domain Sequences for d4ga9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ga9a_ b.29.1.3 (A:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acglvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkvkcvafe
SCOPe Domain Coordinates for d4ga9a_:
Click to download the PDB-style file with coordinates for d4ga9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ga9a_:
- d4ga9a_ first appeared in SCOPe 2.03
- d4ga9a_ appears in SCOPe 2.07
View in 3D
