PDB entry 4ga9

View 4ga9 on RCSB PDB site
Description: Crystal Structure of Rat Galectin-1 in Complex with Lactose
Class: Carbohydrate-binding protein
Keywords: jellyroll like/beta barrel, Carbohydrate-binding protein
Deposited on 2012-07-25, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11762 (0-133)
      • conflict (127)
    Domains in SCOPe 2.08: d4ga9a_
  • Chain 'B':
    Compound: galectin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11762 (0-133)
      • conflict (127)
    Domains in SCOPe 2.08: d4ga9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ga9A (A:)
acglvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkvkcvafe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ga9B (B:)
acglvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkvkcvafe