Lineage for d1slta_ (1slt A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein Galectin-1 [100925] (5 species) 
Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries) 
Domain d1slta_: 1slt A: [24186]
complexed with cl
Details for d1slta_
PDB Entry: 1slt (more details), 1.9 Å
PDB Description: structure of s-lectin, a developmentally regulated vertebrate beta- galactoside binding protein
PDB Compounds: (A:) bovine galectin-1SCOPe Domain Sequences for d1slta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1slta_ b.29.1.3 (A:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]}
cglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcn
skdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyls
aggdfkikcvafe
SCOPe Domain Coordinates for d1slta_:
Click to download the PDB-style file with coordinates for d1slta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1slta_:
- d1slta_ first appeared (with stable ids) in SCOP 1.55
- d1slta_ appears in SCOPe 2.07
View in 3D
