PDB entry 1slt

View 1slt on RCSB PDB site
Description: structure of s-lectin, a developmentally regulated vertebrate beta-galactoside binding protein
Class: lectin
Keywords: lectin
Deposited on 1993-10-20, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine galectin-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1slta_
  • Chain 'B':
    Compound: bovine galectin-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sltb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sltA (A:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sltA (A:)
    cglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcn
    skdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyls
    aggdfkikcvafe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sltB (B:)
    acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
    nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
    saggdfkikcvafe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sltB (B:)
    glvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcns
    kdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainylsa
    ggdfkikcvafe