| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein Galectin-1 [100925] (5 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries) |
| Domain d4ga9b_: 4ga9 B: [221822] automated match to d1slta_ |
PDB Entry: 4ga9 (more details), 1.88 Å
SCOPe Domain Sequences for d4ga9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ga9b_ b.29.1.3 (B:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acglvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkvkcvafe
Timeline for d4ga9b_: