Class b: All beta proteins [48724] (178 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (21 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries) |
Domain d4dgda_: 4dgd A: [196073] automated match to d2wlwa_ complexed with gol; mutant |
PDB Entry: 4dgd (more details), 1.4 Å
SCOPe Domain Sequences for d4dgda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dgda_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf mcqggnfthcngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d4dgda_: