PDB entry 4dgd

View 4dgd on RCSB PDB site
Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant
Class: isomerase
Keywords: anti-viral protein, ISOMERASE
Deposited on 2012-01-25, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trimcyp
    Species: Macaca mulatta [TaxId:9544]
    Gene: TRIMCyp
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0LJC8 (0-164)
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4dgda_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4dgdA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggnfthcngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle