SCOPe 2.06: Domain d4dgda_: 4dgd A:

Lineage for d4dgda_ (4dgd A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries)

8. Domain d4dgda_: 4dgd A: [196073]
   automated match to d2wlwa_
   complexed with gol; mutant

Details for d4dgda_

PDB Entry: 4dgd, 1.4 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant

PDB Compounds: (A:) trimcyp

SCOPe Domain Sequences for d4dgda_:

Sequence; same for both SEQRES and ATOM records:

>d4dgda_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggnfthcngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d4dgda_:

• d4dgda_ first appeared in SCOPe 2.02
  
• d4dgda_ appears in SCOPe 2.05
  
• d4dgda_ appears in SCOPe 2.07
  
• d4dgda_ appears in the current release, SCOPe 2.08