Lineage for d4cu6a4 (4cu6 A:426-757)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830870Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419696] (3 PDB entries)
  8. 2830873Domain d4cu6a4: 4cu6 A:426-757 [413718]
    Other proteins in same PDB: d4cu6a1, d4cu6a2, d4cu6a3, d4cu6a5
    complexed with edo, so4

Details for d4cu6a4

PDB Entry: 4cu6 (more details), 2.7 Å

PDB Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cu6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cu6a4 c.1.8.3 (A:426-757) beta-Galactosidase, domain 3 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
yyhwtpnegfslngerikfhgvslhhdhgalgaeenykaeyrrlkqmkemgvnsirtthn
paseqtlqiaaelgllvqeeafdtwyggkkpydygrffekdathpearkgekwsdfdlrt
mvergknnpaifmwsigneigeangdahslatvkrlvkvikdvdktryvtmgadkfrfgn
gsgghekiadeldavgfnysednykalrakhpkwliygsetssatrtrgsyyrperelkh
sngpernyeqsdygndrvgwgktataswtfdrdnagyagqfiwtgtdyigeptpwhnqnq
tpvkssyfgivdtagipkhdfylyqsqwvsvk

SCOPe Domain Coordinates for d4cu6a4:

Click to download the PDB-style file with coordinates for d4cu6a4.
(The format of our PDB-style files is described here.)

Timeline for d4cu6a4:

  • d4cu6a4 is new in SCOPe 2.08-stable