Lineage for d4cu6a3 (4cu6 A:866-984)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762879Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419695] (3 PDB entries)
  8. 2762885Domain d4cu6a3: 4cu6 A:866-984 [413717]
    Other proteins in same PDB: d4cu6a1, d4cu6a4, d4cu6a5
    complexed with edo, so4

Details for d4cu6a3

PDB Entry: 4cu6 (more details), 2.7 Å

PDB Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cu6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cu6a3 b.1.4.1 (A:866-984) beta-Galactosidase, domains 2 and 4 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
kpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqgqlvgvdnge
qasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqvtvftgkke

SCOPe Domain Coordinates for d4cu6a3:

Click to download the PDB-style file with coordinates for d4cu6a3.
(The format of our PDB-style files is described here.)

Timeline for d4cu6a3:

  • d4cu6a3 is new in SCOPe 2.08-stable