PDB entry 4cu6

View 4cu6 on RCSB PDB site
Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-03-17, released 2014-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18031
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cu6A (A:)
    avtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdh
    espaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngy
    nqfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtdkvhvekngtti
    ltpkleeqqhgkvethvtskivntddkdhelvaeyqivergghavtglvrtasrtlkahe
    stsldaileverpklwtvlndkpalyelitrvyrdgqlvdakkdlfgyryyhwtpnegfs
    lngerikfhgvslhhdhgalgaeenykaeyrrlkqmkemgvnsirtthnpaseqtlqiaa
    elgllvqeeafdtwyggkkpydygrffekdathpearkgekwsdfdlrtmvergknnpai
    fmwsigneigeangdahslatvkrlvkvikdvdktryvtmgadkfrfgngsgghekiade
    ldavgfnysednykalrakhpkwliygsetssatrtrgsyyrperelkhsngpernyeqs
    dygndrvgwgktataswtfdrdnagyagqfiwtgtdyigeptpwhnqnqtpvkssyfgiv
    dtagipkhdfylyqsqwvsvkkkpmvhllphwnwenkelaskvadsegkipvraysnass
    velflngkslglktfnkkqtsdgrtyqegananelylewkvayqpgtleaiardesgkei
    ardkittagkpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqg
    qlvgvdngeqasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqv
    tvftgkkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cu6A (A:)
    vtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdhe
    spaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngyn
    qfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtdkvhvekngttil
    tpkleeqqhgkvethvtskivntddkdhelvaeyqivergghavtglvrtasrtlkahes
    tsldaileverpklwtvlndkpalyelitrvyrdgqlvdakkdlfgyryyhwtpnegfsl
    ngerikfhgvslhhdhgalgaeenykaeyrrlkqmkemgvnsirtthnpaseqtlqiaae
    lgllvqeeafdtwyggkkpydygrffekdathpearkgekwsdfdlrtmvergknnpaif
    mwsigneigeangdahslatvkrlvkvikdvdktryvtmgadkfrfgngsgghekiadel
    davgfnysednykalrakhpkwliygsetssatrtrgsyyrperelkhsngpernyeqsd
    ygndrvgwgktataswtfdrdnagyagqfiwtgtdyigeptpwhnqnqtpvkssyfgivd
    tagipkhdfylyqsqwvsvkkkpmvhllphwnwenkelaskvadsegkipvraysnassv
    elflngkslglktfnkkqtsdgrtyqegananelylewkvayqpgtleaiardesgkeia
    rdkittagkpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqgq
    lvgvdngeqasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqvt
    vftgkke