Lineage for d4cu6a1 (4cu6 A:138-305)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774459Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419694] (3 PDB entries)
  8. 2774462Domain d4cu6a1: 4cu6 A:138-305 [413715]
    Other proteins in same PDB: d4cu6a2, d4cu6a3, d4cu6a4, d4cu6a5
    complexed with edo, so4

Details for d4cu6a1

PDB Entry: 4cu6 (more details), 2.7 Å

PDB Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cu6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cu6a1 b.18.1.5 (A:138-305) beta-Galactosidase {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
vtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdhe
spaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngyn
qfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtd

SCOPe Domain Coordinates for d4cu6a1:

Click to download the PDB-style file with coordinates for d4cu6a1.
(The format of our PDB-style files is described here.)

Timeline for d4cu6a1:

  • d4cu6a1 is new in SCOPe 2.08-stable