Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (3 species) |
Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419694] (3 PDB entries) |
Domain d4cu6a1: 4cu6 A:138-305 [413715] Other proteins in same PDB: d4cu6a2, d4cu6a3, d4cu6a4, d4cu6a5 complexed with edo, so4 |
PDB Entry: 4cu6 (more details), 2.7 Å
SCOPe Domain Sequences for d4cu6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cu6a1 b.18.1.5 (A:138-305) beta-Galactosidase {Streptococcus pneumoniae TIGR4 [TaxId: 170187]} vtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdhe spaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngyn qfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtd
Timeline for d4cu6a1:
View in 3D Domains from same chain: (mouse over for more information) d4cu6a2, d4cu6a3, d4cu6a4, d4cu6a5 |