Lineage for d4chsa1 (4chs A:2-83)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880314Species Soybean (Glycine max) [TaxId:3847] [225579] (5 PDB entries)
  8. 2880315Domain d4chsa1: 4chs A:2-83 [261752]
    Other proteins in same PDB: d4chsa2, d4chsb2
    automated match to d3fhsa1
    complexed with acn, gs8

Details for d4chsa1

PDB Entry: 4chs (more details), 1.6 Å

PDB Description: crystal structure of a tau class glutathione transferase 10 from glycine max
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4chsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4chsa1 c.47.1.0 (A:2-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
tdevvlldfwpspfgmrvrialaekgieyeykeedlrnksplllqmnpvhkkipvlihng
kpisesliavqyieevwndrnp

SCOPe Domain Coordinates for d4chsa1:

Click to download the PDB-style file with coordinates for d4chsa1.
(The format of our PDB-style files is described here.)

Timeline for d4chsa1:

2880315
d4chsa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4chsa2