SCOPe 2.08: Domain d4chsb2: 4chs B:84-219

Lineage for d4chsb2 (4chs B:84-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)

8. Domain d4chsb2: 4chs B:84-219 [261754]
   Other proteins in same PDB: d4chsa1, d4chsb1
   automated match to d2vo4a2
   complexed with acn, gs8

Details for d4chsb2

PDB Entry: 4chs, 1.6 Å

PDB Description: crystal structure of a tau class glutathione transferase 10 from glycine max

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4chsb2:

Sequence; same for both SEQRES and ATOM records:

>d4chsb2 a.45.1.0 (B:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqarfwadyvdikihdlgkkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnigfvdialvpfytwfkvyetfgslnienecprfvawakrclqkesvakslpdqh
kvyefvveirkklvie

Timeline for d4chsb2:

• d4chsb2 first appeared in SCOPe 2.04
  
• d4chsb2 appears in SCOPe 2.07