Lineage for d4ceya_ (4cey A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087321Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries)
  8. 2087336Domain d4ceya_: 4cey A: [236694]
    Other proteins in same PDB: d4ceyc_
    automated match to d3vbfa_
    complexed with 906, na

Details for d4ceya_

PDB Entry: 4cey (more details), 2.75 Å

PDB Description: Crystal structure of human Enterovirus 71 in complex with the uncoating inhibitor NLD
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d4ceya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ceya_ b.121.4.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
esmietrcvlnshstaettldsffsraglvgeidlplegttnpngyanwdiditgyaqmr
rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrtvgt
skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl

SCOPe Domain Coordinates for d4ceya_:

Click to download the PDB-style file with coordinates for d4ceya_.
(The format of our PDB-style files is described here.)

Timeline for d4ceya_: