Lineage for d4ca1a_ (4ca1 A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.8: TRAF domain-like [49598] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-keySuperfamily b.8.1: TRAF domain-like [49599] (3 families) 
has a circularly permuted immunoglobulin-fold topology with extra strand
Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
automatically mapped to Pfam PF03145Protein automated matches [190456] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries) 
Domain d4ca1a_: 4ca1 A: [229565]
automated match to d4c9za_
complexed with cl, gol, so4, zn
Details for d4ca1a_
PDB Entry: 4ca1 (more details), 1.58 Å
PDB Description: Crystal structure of Siah1 at 1.58 A resolution.
PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH1SCOPe Domain Sequences for d4ca1a_:
Sequence, based on SEQRES records: (download)
>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivq
ligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaen
gnlginvtismc
Sequence, based on observed residues (ATOM records): (download)
>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekhqqffaivqlig
trkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengnl
ginvtismc
SCOPe Domain Coordinates for d4ca1a_:
Click to download the PDB-style file with coordinates for d4ca1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ca1a_:
- d4ca1a_ first appeared in SCOPe 2.03
- d4ca1a_ appears in SCOPe 2.05
- d4ca1a_ appears in SCOPe 2.07
- d4ca1a_ appears in the current release, SCOPe 2.08
View in 3D
