SCOPe 2.08: Domain d4ca1a_: 4ca1 A:

Lineage for d4ca1a_ (4ca1 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
   automatically mapped to Pfam PF03145

6. Protein automated matches [190456] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries)

8. Domain d4ca1a_: 4ca1 A: [229565]
   automated match to d4c9za_
   complexed with cl, gol, so4, zn

Details for d4ca1a_

PDB Entry: 4ca1, 1.58 Å

PDB Description: Crystal structure of Siah1 at 1.58 A resolution.

PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH1

SCOPe Domain Sequences for d4ca1a_:

Sequence, based on SEQRES records:

>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivq
ligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaen
gnlginvtismc

Sequence, based on observed residues (ATOM records):

>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekhqqffaivqlig
trkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengnl
ginvtismc

Timeline for d4ca1a_:

• d4ca1a_ first appeared in SCOPe 2.03
  
• d4ca1a_ appears in SCOPe 2.07