Class b: All beta proteins [48724] (176 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins) automatically mapped to Pfam PF03145 |
Protein automated matches [190456] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187371] (3 PDB entries) |
Domain d4ca1a_: 4ca1 A: [229565] automated match to d4c9za_ complexed with cl, gol, so4, zn |
PDB Entry: 4ca1 (more details), 1.58 Å
SCOPe Domain Sequences for d4ca1a_:
Sequence, based on SEQRES records: (download)
>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivq ligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaen gnlginvtismc
>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekhqqffaivqlig trkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengnl ginvtismc
Timeline for d4ca1a_: