Lineage for d4ca1a_ (4ca1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776288Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776289Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1776374Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
    automatically mapped to Pfam PF03145
  6. 1776383Protein automated matches [190456] (1 species)
    not a true protein
  7. 1776384Species Human (Homo sapiens) [TaxId:9606] [187371] (3 PDB entries)
  8. 1776385Domain d4ca1a_: 4ca1 A: [229565]
    automated match to d4c9za_
    complexed with cl, gol, so4, zn

Details for d4ca1a_

PDB Entry: 4ca1 (more details), 1.58 Å

PDB Description: Crystal structure of Siah1 at 1.58 A resolution.
PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH1

SCOPe Domain Sequences for d4ca1a_:

Sequence, based on SEQRES records: (download)

>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivq
ligtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaen
gnlginvtismc

Sequence, based on observed residues (ATOM records): (download)

>d4ca1a_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ansvlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmh
qhksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekhqqffaivqlig
trkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengnl
ginvtismc

SCOPe Domain Coordinates for d4ca1a_:

Click to download the PDB-style file with coordinates for d4ca1a_.
(The format of our PDB-style files is described here.)

Timeline for d4ca1a_: