Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [256465] (6 PDB entries) |
Domain d3wcba_: 3wcb A: [256467] automated match to d1ezfa_ complexed with 8ph |
PDB Entry: 3wcb (more details), 3 Å
SCOPe Domain Sequences for d3wcba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcba_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]} dedlrfcydilqavsrsfavvimeldeemrdavcifylvlraldtveddmsipvefklre lpkfhehlhdttwcmsgvgvgrerellerythvtraysrlgkayqdvisgicermangmc dfltrkvetkadydlychyvaglvghgltllyvssgledvrladdltnanhmglflqktn iirdfyedicevpprvfwpreiwekytddlhafkdelheakaveclnamvadalvhvphv veylaslrdpsvftfsaipqvmamatlslvfnnkdvfhtkvkttrgatarifhystelqa tlqmlktytlrlaarmnaqdacydriehlvndairameshq
Timeline for d3wcba_: