Lineage for d3wcba_ (3wcb A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504597Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1504598Protein automated matches [196409] (27 species)
    not a true protein
  7. 1504703Species Trypanosoma cruzi [TaxId:353153] [256465] (3 PDB entries)
  8. 1504707Domain d3wcba_: 3wcb A: [256467]
    automated match to d1ezfa_
    complexed with 8ph

Details for d3wcba_

PDB Entry: 3wcb (more details), 3 Å

PDB Description: The complex structure of TcSQS with ligand, BPH1237
PDB Compounds: (A:) Farnesyltransferase, putative

SCOPe Domain Sequences for d3wcba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcba_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
dedlrfcydilqavsrsfavvimeldeemrdavcifylvlraldtveddmsipvefklre
lpkfhehlhdttwcmsgvgvgrerellerythvtraysrlgkayqdvisgicermangmc
dfltrkvetkadydlychyvaglvghgltllyvssgledvrladdltnanhmglflqktn
iirdfyedicevpprvfwpreiwekytddlhafkdelheakaveclnamvadalvhvphv
veylaslrdpsvftfsaipqvmamatlslvfnnkdvfhtkvkttrgatarifhystelqa
tlqmlktytlrlaarmnaqdacydriehlvndairameshq

SCOPe Domain Coordinates for d3wcba_:

Click to download the PDB-style file with coordinates for d3wcba_.
(The format of our PDB-style files is described here.)

Timeline for d3wcba_: