Lineage for d3wcbb_ (3wcb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732126Species Trypanosoma cruzi [TaxId:353153] [256465] (6 PDB entries)
  8. 2732148Domain d3wcbb_: 3wcb B: [262378]
    automated match to d3wcba_
    complexed with 8ph

Details for d3wcbb_

PDB Entry: 3wcb (more details), 3 Å

PDB Description: The complex structure of TcSQS with ligand, BPH1237
PDB Compounds: (B:) Farnesyltransferase, putative

SCOPe Domain Sequences for d3wcbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcbb_ a.128.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
dedlrfcydilqavsrsfavvimeldeemrdavcifylvlraldtveddmsipvefklre
lpkfhehlhdttwcmsgvgvgrerellerythvtraysrlgkayqdvisgicermangmc
dfltrkvetkadydlychyvaglvghgltllyvssgledvrladdltnanhmglflqktn
iirdfyedicevpprvfwpreiwekytddlhafkdelheakaveclnamvadalvhvphv
veylaslrdpsvftfsaipqvmamatlslvfnnkdvfhtkvkttrgatarifhystelqa
tlqmlktytlrlaarmnaqdacydriehlvndairameshq

SCOPe Domain Coordinates for d3wcbb_:

Click to download the PDB-style file with coordinates for d3wcbb_.
(The format of our PDB-style files is described here.)

Timeline for d3wcbb_: