Lineage for d3ujna1 (3ujn A:-7-152)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688280Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1688281Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 1688299Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein)
    duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer
  6. 1688300Protein FGAM synthase PurL, PurS-like domain [111003] (3 species)
  7. 1688301Species Salmonella enterica [TaxId:90371] [227347] (2 PDB entries)
  8. 1688303Domain d3ujna1: 3ujn A:-7-152 [227348]
    Other proteins in same PDB: d3ujna2, d3ujna3, d3ujna4, d3ujna5, d3ujna6, d3ujna7
    automated match to d1t3ta3
    complexed with adp, mg, so4

Details for d3ujna1

PDB Entry: 3ujn (more details), 2.98 Å

PDB Description: Formyl Glycinamide Ribonucleotide Amidotransferase from Salmonella Typhimurium : Role of the ATP complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ujna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujna1 d.284.1.2 (A:-7-152) FGAM synthase PurL, PurS-like domain {Salmonella enterica [TaxId: 90371]}
glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
yieastltaeqwrqvaaelhdrmmetvfssltdaeklfih

SCOPe Domain Coordinates for d3ujna1:

Click to download the PDB-style file with coordinates for d3ujna1.
(The format of our PDB-style files is described here.)

Timeline for d3ujna1: