SCOPe 2.04: Domain d3ujna3: 3ujn A:221-429

Lineage for d3ujna3 (3ujn A:221-429)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)

7. Species Salmonella enterica [TaxId:90371] [227351] (2 PDB entries)

8. Domain d3ujna3: 3ujn A:221-429 [227352]
   Other proteins in same PDB: d3ujna1, d3ujna2, d3ujna4, d3ujna6, d3ujna7
   automated match to d1t3ta4
   complexed with adp, mg, so4

Details for d3ujna3

PDB Entry: 3ujn, 2.98 Å

PDB Description: Formyl Glycinamide Ribonucleotide Amidotransferase from Salmonella Typhimurium : Role of the ATP complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ujna3:

Sequence; same for both SEQRES and ATOM records:

>d3ujna3 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]}
ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry
dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl
ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn
geelrgyhkpimlaggigniradhvqkge

Timeline for d3ujna3:

• d3ujna3 first appeared in SCOPe 2.03
  
• d3ujna3 appears in SCOPe 2.05
  
• d3ujna3 appears in the current release, SCOPe 2.08