Lineage for d3s9ka_ (3s9k A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1919138Protein automated matches [190202] (2 species)
    not a true protein
  7. 1919159Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries)
  8. 1919171Domain d3s9ka_: 3s9k A: [193809]
    automated match to d1luka_
    complexed with cit

Details for d3s9ka_

PDB Entry: 3s9k (more details), 2.35 Å

PDB Description: Crystal structure of the Itk SH2 domain.
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3s9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s9ka_ d.93.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikhy
hiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcgspgihrd

SCOPe Domain Coordinates for d3s9ka_:

Click to download the PDB-style file with coordinates for d3s9ka_.
(The format of our PDB-style files is described here.)

Timeline for d3s9ka_: