SCOPe 2.08: Domain d3s9ka1: 3s9k A:5-110

Lineage for d3s9ka1 (3s9k A:5-110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries)

8. Domain d3s9ka1: 3s9k A:5-110 [193809]
   Other proteins in same PDB: d3s9ka2
   automated match to d1luka_
   complexed with cit

Details for d3s9ka1

PDB Entry: 3s9k, 2.35 Å

PDB Description: Crystal structure of the Itk SH2 domain.

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3s9ka1:

Sequence; same for both SEQRES and ATOM records:

>d3s9ka1 d.93.1.1 (A:5-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikhy
hiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc

Timeline for d3s9ka1:

• d3s9ka1 first appeared in SCOPe 2.02, called d3s9ka_
  
• d3s9ka1 appears in SCOPe 2.07