SCOPe 2.02: Domain d3s9ka_: 3s9k A:

Lineage for d3s9ka_ (3s9k A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187800] (4 PDB entries)

8. Domain d3s9ka_: 3s9k A: [193809]
   automated match to d1luka_
   complexed with cit

Details for d3s9ka_

PDB Entry: 3s9k, 2.35 Å

PDB Description: Crystal structure of the Itk SH2 domain.

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3s9ka_:

Sequence; same for both SEQRES and ATOM records:

>d3s9ka_ d.93.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikhy
hiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcgspgihrd

Timeline for d3s9ka_:

• d3s9ka_ is new in SCOPe 2.02-stable
  
• d3s9ka_ appears in SCOPe 2.03
  
• d3s9ka_ appears in the current release, SCOPe 2.08, called d3s9ka1