SCOPe 2.08: Domain d3r06l1: 3r06 L:1-107

Lineage for d3r06l1 (3r06 L:1-107)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (31 species)
not a true protein
Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)
Domain d3r06l1: 3r06 L:1-107 [233383]
Other proteins in same PDB: d3r06b_, d3r06d_, d3r06f_, d3r06h_
automated match to d1l7tl1

Details for d3r06l1

PDB Entry: 3r06 (more details), 2.5 Å

PDB Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment

PDB Compounds: (L:) anti-mouse CD3epsilon antibody 2C11 Fab light chain

SCOPe Domain Sequences for d3r06l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r06l1 b.1.1.0 (L:1-107) automated matches {Cricetulus migratorius [TaxId: 10032]}
diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleik

SCOPe Domain Coordinates for d3r06l1:

Click to download the PDB-style file with coordinates for d3r06l1.
(The format of our PDB-style files is described here.)

Timeline for d3r06l1: