SCOPe 2.08: Domain d3r06c2: 3r06 C:108-213

Lineage for d3r06c2 (3r06 C:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)

8. Domain d3r06c2: 3r06 C:108-213 [239675]
   Other proteins in same PDB: d3r06b_, d3r06d_, d3r06f_, d3r06h_
   automated match to d3r06l2

Details for d3r06c2

PDB Entry: 3r06, 2.5 Å

PDB Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment

PDB Compounds: (C:) anti-mouse CD3epsilon antibody 2C11 Fab light chain

SCOPe Domain Sequences for d3r06c2:

Sequence; same for both SEQRES and ATOM records:

>d3r06c2 b.1.1.0 (C:108-213) automated matches {Cricetulus migratorius [TaxId: 10032]}
radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd
skdstyslsstlsltkadyerhnlytcevthktstaaivktlnrne

Timeline for d3r06c2:

• d3r06c2 first appeared in SCOPe 2.04
  
• d3r06c2 appears in SCOPe 2.07