![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries) |
![]() | Domain d3r06l2: 3r06 L:108-213 [233384] Other proteins in same PDB: d3r06b_, d3r06d_, d3r06f_, d3r06h_ automated match to d1l7tl2 |
PDB Entry: 3r06 (more details), 2.5 Å
SCOPe Domain Sequences for d3r06l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r06l2 b.1.1.0 (L:108-213) automated matches {Cricetulus migratorius [TaxId: 10032]} radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd skdstyslsstlsltkadyerhnlytcevthktstaaivktlnrne
Timeline for d3r06l2: