Lineage for d3r06c1 (3r06 C:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754215Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)
  8. 2754218Domain d3r06c1: 3r06 C:1-107 [239674]
    Other proteins in same PDB: d3r06b_, d3r06d_, d3r06f_, d3r06h_
    automated match to d3r06l1

Details for d3r06c1

PDB Entry: 3r06 (more details), 2.5 Å

PDB Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment
PDB Compounds: (C:) anti-mouse CD3epsilon antibody 2C11 Fab light chain

SCOPe Domain Sequences for d3r06c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r06c1 b.1.1.0 (C:1-107) automated matches {Cricetulus migratorius [TaxId: 10032]}
diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleik

SCOPe Domain Coordinates for d3r06c1:

Click to download the PDB-style file with coordinates for d3r06c1.
(The format of our PDB-style files is described here.)

Timeline for d3r06c1: