![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
![]() | Domain d3pseb1: 3pse B:4-78 [233268] automated match to d1z2ma1 complexed with 3cn, gol |
PDB Entry: 3pse (more details), 2.3 Å
SCOPe Domain Sequences for d3pseb1:
Sequence, based on SEQRES records: (download)
>d3pseb1 d.15.1.1 (B:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq glgpgstvllvvdks
>d3pseb1 d.15.1.1 (B:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} dltvkmlagnefqvslmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasqglg pgstvllvvdks
Timeline for d3pseb1: