Lineage for d3om9a1 (3om9 A:14-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844993Species Toxoplasma gondii [TaxId:5811] [233099] (1 PDB entry)
  8. 2844994Domain d3om9a1: 3om9 A:14-163 [233100]
    Other proteins in same PDB: d3om9a2, d3om9a3, d3om9b2, d3om9b3, d3om9c2, d3om9d2
    automated match to d1pzga1
    complexed with nad, oxq

Details for d3om9a1

PDB Entry: 3om9 (more details), 1.98 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d3om9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om9a1 c.2.1.5 (A:14-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOPe Domain Coordinates for d3om9a1:

Click to download the PDB-style file with coordinates for d3om9a1.
(The format of our PDB-style files is described here.)

Timeline for d3om9a1: