Lineage for d3om9b2 (3om9 B:164-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999455Species Toxoplasma gondii [TaxId:5811] [233101] (1 PDB entry)
  8. 2999457Domain d3om9b2: 3om9 B:164-333 [233106]
    Other proteins in same PDB: d3om9a1, d3om9a3, d3om9b1, d3om9b3, d3om9c1, d3om9d1
    automated match to d1pzgc2
    complexed with nad, oxq

Details for d3om9b2

PDB Entry: 3om9 (more details), 1.98 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d3om9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om9b2 d.162.1.1 (B:164-333) automated matches {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalqa

SCOPe Domain Coordinates for d3om9b2:

Click to download the PDB-style file with coordinates for d3om9b2.
(The format of our PDB-style files is described here.)

Timeline for d3om9b2: